top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
NUTM2A-AS1:26 | OV | 20 | 0.199238 | noncoding | 87 | chr10 | 87207906 | 87216799 | - | 0.6296 | NUTM2A-AS1 | 0.212 | -4.428 | -5.013 | -4.152 | 1 | noncoding | -0.297350758 | VLSLYLFNCSFCPIFLPSSK | n[145]VLSLYLFNCSFCPIFLPSSK | MQFCFYLSCLGIIKLYQFWKVLSLYLFNCSFCPIFLPSSKTPVTYVLGLFTTSHKYLMFFAVFSILFVSVFQLRVFILSCITVQRMF |
NUTM2A-AS1:27 | OSCC | 8 | 0.181929 | noncoding | 44 | chr10 | 87206718 | 87214544 | - | 0.9846 | NUTM2A-AS1 | 0.177 | -5.506 | -4.425 | -3.984 | 8 | coding | 0.691276966 | ENTLLWGK | n[145]ENTLLWGK | LLFQPGFLCLLPGRENTLLWGKSQGGRCDQHTQAPSVGMAHCAG |
NUTM2A-AS1:34 | OV | 10 | 0.0969719 | noncoding | 47 | chr10 | 87320199 | 87342590 | - | 0.9974 | NUTM2A-AS1 | 0.028 | 0 | 0 | 0 | 5 | coding | 0.688512928 | SEVFLTHLDR | n[145]SEVFLTHLDR | MRKAILRSHVTHLDRSEVFLTHLDRSEVTSPCGKTTFNFVRNCKAIF |
NFIA-AS1:12 | LUAD | 10 | 0.0557533 | noncoding | 73 | chr1 | 61247716 | 61253503 | - | 0.9975 | NFIA-AS1 | 1 | -3.092 | -3.657 | -5.419 | 1 | noncoding | -0.446915791 | AGTQNQINSK | n[230]AGTQNQINSK | LCSNFGTMISAMFSNRVRKQTALREKAGTQNQINSKLKFSHFDKELHVFFCLLQMYVIKVGCLPFKTFEWITK |
NFIA-AS2:16 | EOGC | 18 | 0.0146593 | noncoding | 46 | chr1 | 60954093 | 60970740 | - | 0.9998 | NFIA-AS2 | 1 | -1.422 | -3.244 | -4.021 | 2 | noncoding | -0.362168601 | ANVLHFRTLISLGLPAEK | n[145]ANVLHFRTLISLGLPAEK | LYEHVTITPPTVKANVLHFRTLISLGLPAEKQSLTLFLTNAFRHAL |
Page 1 of 1
bottom of page