top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
NUCB1-AS1:1 | HCC | 9 | 0.0152094 | noncoding | 63 | chr19 | 48910929 | 48918891 | - | 0.9969 | NUCB1-AS1 | 1 | -4.194 | 11.122 | 6.155 | 12 | noncoding | -0.382092432 | LSSHPGGFK | n[230]LSSHPGGFK | LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR |
NUCB1-AS1:1 | HCC | 9 | 0.0152094 | noncoding | 63 | chr19 | 48910929 | 48918891 | - | 0.9969 | NUCB1-AS1 | 1 | -4.194 | 11.122 | 6.155 | 12 | noncoding | -0.382092432 | LSSHPGGFK | n[43]LSSHPGGFK | LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR |
NUCB1-AS1:1 | HCC | 7 | 0.0152094 | noncoding | 63 | chr19 | 48910929 | 48918891 | - | 0.8851 | NUCB1-AS1 | 1 | -4.194 | 11.122 | 6.155 | 2 | noncoding | -0.382092432 | MLTSLVK | n[230]MLTSLVK | LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR |
NUCB1-AS1:1 | HCC | 10 | 0.0152094 | noncoding | 63 | chr19 | 48910929 | 48918891 | - | 0.902 | NUCB1-AS1 | 1 | -4.194 | 11.122 | 6.155 | 13 | noncoding | -0.382092432 | TPSLLISEGK | TPSLLISEGK | LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR |
NUCB1-AS1:1 | HCC | 10 | 0.0152094 | noncoding | 63 | chr19 | 48910929 | 48918891 | - | 0.902 | NUCB1-AS1 | 1 | -4.194 | 11.122 | 6.155 | 13 | noncoding | -0.382092432 | TPSLLISEGK | n[230]TPSLLISEGK | LSSHPGGFKGTAGGNKWLIWASLQVPEASKMLTSLVKSASSSCSSRTPSLLISEGKRIARRFR |
Page 1 of 1
bottom of page