top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
OVCH1-AS1:7 | CCRC | 15 | 0.13143 | noncoding | 44 | chr12 | 29389288 | 29394817 | + | 0.9943 | OVCH1-AS1 | 0.051 | 0 | 0 | 0 | 5 | noncoding | -0.27616697 | GGGGAESSMTSCLQR | n[230]GGGGAESSM[147]TSCLQR | MLIVQCGSGEERGGGGAESSMTSCLQRGKMNHYLCAFCFTYLCI |
P3H2-AS1:6 | OSCC | 17 | 0.974387 | coding | 38 | chr3 | 190120951 | 190150133 | + | 0.63 | P3H2-AS1 | 0 | 0 | 0 | 0 | 1 | noncoding | -0.323277616 | MAPLAATLRHFTALDPK | n[145]M[147]APLAATLRHFTALDPK | MAPLAATLRHFTALDPKRSKGRLILKIHFITQSAPNIK |
P3H2-AS1:7 | LUAD | 25 | 0.934144 | coding | 77 | chr3 | 190120951 | 190150133 | + | 0.4637 | P3H2-AS1 | 0 | 0 | 0 | 0 | 2 | noncoding | -0.323277616 | ITNYAQLTPHISHNFQNLFSSSYLK | ITNYAQLTPHISHNFQNLFSSSYLK | LRAVAVAALILLEALKITNYAQLTPHISHNFQNLFSSSYLKHILSAPRLLQLYSLFAKSHNYHCSWPRLQSGLPHYS |
P3H2-AS1:7 | LUAD | 10 | 0.934144 | coding | 77 | chr3 | 190120951 | 190150133 | + | 0.8801 | P3H2-AS1 | 0 | 0 | 0 | 0 | 7 | noncoding | -0.323277616 | LLQLYSLFAK | n[230]LLQLYSLFAK | LRAVAVAALILLEALKITNYAQLTPHISHNFQNLFSSSYLKHILSAPRLLQLYSLFAKSHNYHCSWPRLQSGLPHYS |
PACRG-AS1:3 | OSCC | 11 | 0.246551 | noncoding | 37 | chr6 | 163309984 | 163324462 | - | 0.9292 | PACRG-AS1 | 0.12 | 0 | 0 | 0 | 1 | noncoding | -0.309305139 | MSVSCLIYGGR | n[145]MSVSCLIYGGR | MSVSCLIYGGRKVHRTRTHVSIPVSGLLSSDSILRAA |
Page 1 of 1
bottom of page