top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
OLMALINC:4 | EOGC | 12 | 0.823747 | coding | 52 | chr10 | 100373449 | 100388314 | + | 0.9974 | OLMALINC | 0.289 | 0 | 0 | 0 | 16 | noncoding | -0.349470362 | ILPLYLPTLIHK | n[145]ILPLYLPTLIHK | LFLDYSHTSLPPFSPVQSLLRILPLYLPTLIHKYGTPLFPPWQPIMHPLPSH |
OR2A1-AS1:19 | OV | 20 | 0.979563 | coding | 106 | chr7 | 144250044 | 144252957 | - | 0.9832 | OR2A1-AS1 | 0.68 | -4.156 | -3.82 | -4.379 | 2 | coding | 0.742030299 | LVTCLLFPTVFLQTGTPYNR | n[145]LVTCLLFPTVFLQTGTPYNR | LVTCLLFPTVFLQTGTPYNRLHLGSLNESHSSAVPPRDFIKAPAVAFWRLLKLSTQCFLKVSCFSPLDCYSHQLHVGFTNLFLRMQVCLLYPRETHLYIPVSTDKN |
OR2A1-AS1:21 | BRCA-Luminal A | 7 | 0.128016 | noncoding | 50 | chr7 | 144250853 | 144256249 | - | 0.9999 | OR2A1-AS1 | 0.019 | -5.216 | -4.07 | -4.124 | 10 | coding | 0.718383635 | VLAHNYK | n[145]VLAHNYK | MKLTLSSSWSTIVLISRKRTYVINSDSIRQLCKVLAHNYKSRLNQTGLLF |
OR2A1-AS1:21 | BRCA-HER2-enriched | 7 | 0.128016 | noncoding | 50 | chr7 | 144250853 | 144256249 | - | 0.9999 | OR2A1-AS1 | 0.019 | -5.216 | -4.07 | -4.124 | 10 | coding | 0.718383635 | VLAHNYK | n[145]VLAHNYK | MKLTLSSSWSTIVLISRKRTYVINSDSIRQLCKVLAHNYKSRLNQTGLLF |
OR2A1-AS1:21 | BRCA-Basal-like | 7 | 0.128016 | noncoding | 50 | chr7 | 144250853 | 144256249 | - | 0.9999 | OR2A1-AS1 | 0.019 | -5.216 | -4.07 | -4.124 | 10 | coding | 0.718383635 | VLAHNYK | n[145]VLAHNYK | MKLTLSSSWSTIVLISRKRTYVINSDSIRQLCKVLAHNYKSRLNQTGLLF |
Page 1 of 1
bottom of page