top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|61587226|61676935|+|2|circRNA|ADGRL3|ENST00000512091.6|4,5 | circADGRL3(4,5) | ADGRL3 | LMFFQTRVQEPINTLKCSMNVSLTLSAVPQFQWLWSAESYPVRAIL | VQEPINTLK | No | Alternative | Junction | 9 | 3 | CTG | TAG | TransCirc | No |
chr4|6598197|6600756|+|2|circRNA|MAN2B2|NM_001292038|9,10 | circMAN2B2(9,10) | MAN2B2 | LLVSLESASQMRRATQCPRRSSTMMPSLGLSPPR | RSSTMMPSLGLSPPR | No | Alternative | Junction | 15 | 1 | CTG | TGA | TransCirc | No |
chr4|67505204|67519502|-|7|circRNA|CENPC|ENST00000273853.10|12,11,10,9,8,7,6 | circCENPC(12,11,10,9,8,7,6) | CENPC | LERMMWMMRKFMEVQFRPMKFIRKFWQLMLVPKIHLTRKKYQVET | KFWQLMLVPK | No | Alternative | Junction | 10 | 3 | CTG | TAA | TransCirc | No |
chr4|6842066|6864183|+|4|circRNA|KIAA0232|ENST00000425103.5|3,4,5,6 | circKIAA0232(3,4,5,6) | KIAA0232 | LGALKEKTCTWRIERTQSIKRSPCGTPSQLLNILFL | EKTCTWR | No | Alternative | Alternative | 7 | 3 | CTG | TGA | TransCirc | No |
chr4|6842066|6864183|+|4|circRNA|KIAA0232|ENST00000425103.5|3,4,5,6 | circKIAA0232(3,4,5,6) | KIAA0232 | LLMKIIQFLRDSWKRRMTSSWAGKKELIRNGERVRKNVQI | MTSSWAGKK | No | Alternative | Junction | 9 | 3 | CTG | TAA | NA | No |
Page 1 of 1
bottom of page