top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|508828|530745|+|7|circRNA|PIGG|NM_001127178|5,6,7,8,9,10,11 | circPIGG(5,6,7,8,9,10,11) | PIGG | LKLVLFMSLSLAFCSRAPKTYLNLKSLLQTSNSRL | LVLFMSLSLAFCSR | No | Alternative | Alternative | 14 | 3 | TTG | TAG | TransCirc | No |
chr4|508828|530745|+|7|circRNA|PIGG|NM_001127178|5,6,7,8,9,10,11 | circPIGG(5,6,7,8,9,10,11) | PIGG | LVKHSSIFRRERRLYPICWFFVVTMACLKQEVTGPPPPRR | LVKHSSIFR | No | Alternative | Junction | 9 | 3 | TTG | TGA | TransCirc | No |
chr4|51848204|51891851|+|7|circRNA|DCUN1D4|NM_001287757|2,3,4,5,6,7,8 | circDCUN1D4(2,3,4,5,6,7,8) | DCUN1D4 | LEIGCTKHGLFYSTGVVKRNDFSPISVLENVAWRNSQGKSKMLVMC | HGLFYSTGVVK | No | Alternative | Junction | 11 | 3 | TTG | TGA | NA | No |
chr4|51848204|51891851|+|7|circRNA|DCUN1D4|NM_001287757|2,3,4,5,6,7,8 | circDCUN1D4(2,3,4,5,6,7,8) | DCUN1D4 | LEIGCTKHGLFYSTGVVKRNDFSPISVLENVAWRNSQGKSKMLVMC | NDFSPISVLENVAWR | No | Junction | Junction | 15 | 3 | TTG | TGA | NA | No |
chr4|51848204|51891851|+|7|circRNA|DCUN1D4|NM_001287757|2,3,4,5,6,7,8 | circDCUN1D4(2,3,4,5,6,7,8) | DCUN1D4 | LEIGCTKHGLFYSTGVVKRNDFSPISVLENVAWRNSQGKSKMLVMC | NDFSPISVLENVAWRNSQGK | No | Junction | Junction | 20 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page