top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|40119931|40122309|+|1|circRNA|N4BP2|ENST00000261435.10|9 | circN4BP2(9) | N4BP2 | LTQIVLWREYHLVLAVVKIIKKTVILQIVDHFKMKNPHLVK | LTQIVLWR | No | Alternative | Alternative | 8 | 2 | CTG | TAG | TransCirc | No |
chr4|40119931|40122309|+|1|circRNA|N4BP2|ENST00000261435.10|9 | circN4BP2(9) | N4BP2 | MRGAIKILFGPQAFCWILKLSYVRIQSLRISKNRVMDHKLGLFLWG | LGLFLWG | No | Alternative | Alternative | 7 | 2 | ATG | TGA | TransCirc | No |
chr4|40890363|40934699|-|4|circRNA|APBB2|ENST00000295974.12|12,11,10,9 | circAPBB2(12,11,10,9) | APBB2 | MYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRICMQPLLTRTPV | DNGRICMQPLLTR | No | Junction | Junction | 13 | 1 | ATG | TAA | TransCirc | No |
chr4|40934455|40945073|-|2|rescued|APBB2|ENST00000295974|37,199|0,10419 | NA | APBB2 | LIQICRLAGKESVTLPGPIIGTSQQERLSGNGPSPSQQISRVLGKGHLVL | LSGNGPSPSQQISR | Yes | Alternative | Alternative | 14 | 2 | CTG | TAA | NA | No |
chr4|41013582|41143142|-|5|circRNA|APBB2|ENST00000295974.12|6,5,4,3,2 | circAPBB2(6,5,4,3,2).A | APBB2 | MRSPAGQRCPKTVPHPAPRMKQVGVAVGELLWSVAKHAVVGSAQPWNRNICWMENP | HAVVGSAQPWNR | No | Alternative | Junction | 12 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page