top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|3316069|3343053|+|2|circRNA|RGS12|NM_002926|2,3 | circRGS12(2,3) | RGS12 | LGGELDSLSLLNARLLGDHLGDPRDSVSLAPLMILRALFEEANMVASSIP | LGGELDSLSLLNAR | No | Alternative | Junction | 14 | 2 | TTG | TGA | TransCirc | No |
chr4|3414071|3422570|+|7|circRNA|RGS12|NM_002926|5,6,7,8,9,10,11 | circRGS12(5,6,7,8,9,10,11) | RGS12 | LQDFGTREGQGHQALLHSSPGWDILRGGCQGGLLHQRHPVRTL | EGQGHQALLHSSPGWDILR | No | Alternative | Alternative | 19 | 3 | CTG | TGA | TransCirc | No |
chr4|3518033|3525051|-|4|circRNA|LRPAP1|NR_110005|5,4,3,2 | circLRPAP1(5,4,3,2) | LRPAP1 | LSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAAASSSREAGRAPR | EAGRAPR | No | Alternative | Junction | 7 | 3 | CTG | TGA | TransCirc | No |
chr4|36107564|36124967|-|6|circRNA|ARAP2|NM_015230|27,26,25,24,23,22 | circARAP2(27,26,25,24,23,22) | ARAP2 | LTQLNTAVIRKMTRKELKNMEHLYVLFQGSTEQH | ELKNMEHLYVLFQGSTEQH | No | Alternative | Junction | 19 | 1 | CTG | TAG | TransCirc | No |
chr4|37631384|37635123|-|2|circRNA|RELL1|ENST00000314117.8|6,5 | circRELL1(6,5) | RELL1 | LGLCHQGGRQGSTSVAIICIRWAVLSRGMCVIGVGTSGGTL | GMCVIGVGTSGGTL | No | Alternative | Alternative | 14 | 1 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page