top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|186609182|186636914|-|12|circRNA|FAT1|NM_005245|16,15,14,13,12,11,10,9,8,7,6,5 | circFAT1(16,15,14,13,12,11,10,9,8,7,6,5) | FAT1 | LMKMTTNLSFCKSSTKSDSLSGKSQTEKEMPDGSRSITS | EMPDGSRSITS | No | Alternative | Alternative | 11 | 2 | TTG | TAG | TransCirc | No |
chr4|186609182|186636914|-|12|circRNA|FAT1|NM_005245|16,15,14,13,12,11,10,9,8,7,6,5 | circFAT1(16,15,14,13,12,11,10,9,8,7,6,5) | FAT1 | LMKMTTNLSFCKSSTKSDSLSGKSQTEKEMPDGSRSITS | LMKMTTNLSFCK | No | Alternative | Alternative | 12 | 2 | TTG | TAG | TransCirc | No |
chr4|186609182|186636914|-|12|circRNA|FAT1|NM_005245|16,15,14,13,12,11,10,9,8,7,6,5 | circFAT1(16,15,14,13,12,11,10,9,8,7,6,5) | FAT1 | LMKMTTNLSFCKSSTKSDSLSGKSQTEKEMPDGSRSITS | MTTNLSFCK | No | Alternative | Alternative | 9 | 2 | TTG | TAG | TransCirc | No |
chr4|186617004|186621775|-|2|circRNA|FAT1|NM_005245|11,10 | circFAT1(11,10) | FAT1 | LSRWTLPTSMIIHHSLNNRFMKPELASTPLMGIS | FMKPELASTPLMGIS | No | Alternative | Alternative | 15 | 3 | TTG | TGA | TransCirc | No |
chr4|186628153|186628763|-|2|circRNA|FAT1|NM_005245|9,8 | circFAT1(9,8) | FAT1 | LQGLWSMSATRMTTPRGSPLPPTKGGFMNRQPLAQLCCR | GGFMNRQPLAQLCCR | No | Alternative | Alternative | 15 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page