top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|150828179|150872755|-|13|circRNA|LRBA|ENST00000510413.5|30,29,28,27,26,25,24,23,22,21,20,19,18 | circLRBA(30,29,28,27,26,25,24,23,22,21,20,19,18) | LRBA | MESQWILPFCHQPALEPLVIYLWNNPCSSDLLTVLSTNFWHRKVKESGYKLLRQWVIF | VLSTNFWHRK | No | Alternative | Junction | 10 | 1 | ATG | TAA | TransCirc | No |
chr4|151099714|151100482|+|1|ciRNA|RPS3A|NM_001267699|1 | ciRPS3A(1) | RPS3A | LGVCWNRRAGPRSRRRPDGEDSSRIVRAVAGWCTQERGLEGRC | AVAGWCTQER | No | Alternative | Alternative | 10 | 2 | TTG | TGA | NA | No |
chr4|151099714|151100482|+|1|ciRNA|RPS3A|NM_001267699|1 | ciRPS3A(1) | RPS3A | LSWRLAFWGSAGIGGLVLDRGVGRMARIPVGLCGPWRVGAPRNAAWRVGVE | GVGRMAR | No | Alternative | Alternative | 7 | 3 | CTG | TAG | NA | No |
chr4|151099714|151100482|+|1|ciRNA|RPS3A|NM_001267699|1 | ciRPS3A(1) | RPS3A | LSWRLAFWGSAGIGGLVLDRGVGRMARIPVGLCGPWRVGAPRNAAWRVGVE | LAFWGSAGIGGLVLDRGVGR | No | Alternative | Alternative | 20 | 3 | CTG | TAG | NA | No |
chr4|151127617|151128356|-|2|circRNA|SH3D19|ENST00000409598.8|19,18 | circSH3D19(19,18) | SH3D19 | MISEGRMKMNFPSRLTVFRQNGVKLFTVLQQRPVMTYHSRGETGSRFWNVWILTGAGADCRTGRGSSQQCL | FWNVWILTGAGADCRTGR | No | Alternative | Junction | 18 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page