top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|102801560|102802560|-|1|ciRNA|UBE2D3|NM_001300795|5 | ciUBE2D3(5) | UBE2D3 | LIILSFALKDVCFYLNKILKSFCFSKYFPSKSVSIDLCFISKE | SVSIDLCFISK | No | Alternative | Junction | 11 | 1 | TTG | TAG | NA | No |
chr4|105233896|105237351|+|1|circRNA|TET2|ENST00000513237.5|3 | circTET2(3) | TET2 | LSHFQTHTFCNISLINRQHKHNHPRVHISLKTSNSSKNYK | VHISLKTSNSSK | No | Alternative | Alternative | 12 | 2 | CTG | TAA | riboCIRC,TransCirc | No |
chr4|10564670|10566150|-|2|circRNA|CLNK|ENST00000226951.10|7,6 | circCLNK(7,6) | CLNK | LDSRPGTHRRGWKEKETLLQSWMEQKATVMMTMMTLSFGWKRHGSRLKFYQPGL | ATVMMTMMTLSFGWKR | No | Alternative | Junction | 16 | 1 | TTG | TAA | NA | No |
chr4|106230362|106242569|-|8|circRNA|TBCK|ENST00000273980.9|20,19,18,17,16,15,14,13 | circTBCK(20,19,18,17,16,15,14,13) | TBCK | LAYACMSAFIPKYLYNFFLKDNSHVIQVFSLRMVKALDKVEIEARF | ALDKVEIEAR | No | Alternative | Junction | 10 | 3 | TTG | TAG | TransCirc | No |
chr4|106230362|106242569|-|8|circRNA|TBCK|ENST00000273980.9|20,19,18,17,16,15,14,13 | circTBCK(20,19,18,17,16,15,14,13) | TBCK | LAYACMSAFIPKYLYNFFLKDNSHVIQVFSLRMVKALDKVEIEARF | DNSHVIQVFSLR | No | Junction | Junction | 12 | 3 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page