top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|10097710|10099139|-|2|circRNA|WDR1|ENST00000499869.6|5,4 | circWDR1(5,4) | WDR1 | LEQSSSGIVALLWARLQDTTKSSTAWTSSRAGHTGWPREAMITARHSLRDPHSSSSSQLACVWEAEDLGYHAEGAPVEV | SSTAWTSSR | No | Alternative | Junction | 9 | 3 | TTG | TGA | NA | No |
chr4|10098991|10103986|-|2|circRNA|WDR1|ENST00000499869.6|4,3 | circWDR1(4,3) | WDR1 | MSTSLSLGRSKTLLGLKTVRGSPWSGKEGRKPSPC | MSTSLSLGR | No | Alternative | Junction | 9 | 1 | ATG | TGA | NA | No |
chr4|102525511|102567135|+|5|circRNA|NFKB1|ENST00000226574.8|2,3,4,5,6 | circNFKB1(2,3,4,5,6).A | NFKB1 | MWDQQRLLFSWSQMEKISTCMPTAWWENTVRMGSAL | ISTCMPTAWWENTVR | No | Alternative | Alternative | 15 | 2 | ATG | TAA | TransCirc | No |
chr4|102525511|102567135|+|5|circRNA|NFKB1|ENST00000226574.8|2,3,4,5,6 | circNFKB1(2,3,4,5,6).A | NFKB1 | MWDQQRLLFSWSQMEKISTCMPTAWWENTVRMGSAL | ISTCMPTAWWENTVRMGSAL | No | Alternative | Alternative | 20 | 2 | ATG | TAA | TransCirc | No |
chr4|102525511|102567135|+|5|circRNA|NFKB1|ENST00000226574.8|2,3,4,5,6 | circNFKB1(2,3,4,5,6).A | NFKB1 | MWDQQRLLFSWSQMEKISTCMPTAWWENTVRMGSAL | LLFSWSQMEK | No | Alternative | Alternative | 10 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page