top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|69029814|69033704|-|2|circRNA|TMF1|ENST00000398559.6|11,10 | circTMF1(11,10) | TMF1 | MRTIETPGSRESKPGTESKCFINNKTIASTNRKFASNPGIPDIVVGEIREESF | TIETPGSR | No | Junction | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
chr3|73602353|73602461|-|1|circRNA|PDZRN3|NM_015009|3 | circPDZRN3(3) | PDZRN3 | LTVGLQPRKEACKFMTGLLRITTMDHPVKESLYPR | LTVGLQPR | No | Alternative | Junction | 8 | 2 | TTG | TAG | TransCirc | No |
chr3|74361889|74371399|-|6|circRNA|CNTN3|ENST00000263665.6|10,9,8,7,6,5 | circCNTN3(10,9,8,7,6,5) | CNTN3 | MLGSSMNTHRLLKKIVGDLSPRRQGTSTYLRWSRLMWEITHVW | IVGDLSPR | No | Alternative | Alternative | 8 | 2 | ATG | TGA | TransCirc | No |
chr3|74361889|74371399|-|6|circRNA|CNTN3|ENST00000263665.6|10,9,8,7,6,5 | circCNTN3(10,9,8,7,6,5) | CNTN3 | MLGSSMNTHRLLKKIVGDLSPRRQGTSTYLRWSRLMWEITHVW | KIVGDLSPR | No | Alternative | Alternative | 9 | 2 | ATG | TGA | TransCirc | No |
chr3|77098013|77098340|+|1|circRNA|ROBO2|ENST00000487694.7|3 | circROBO2(3) | ROBO2 | LSGTKMGSEWRLTRTIPGPTGCFCPADPYSSCASCTGAGVNLMKEATFVLRGTILVKQ | GTILVKQ | No | Alternative | Alternative | 7 | 1 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page