top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|52926030|52928341|-|2|circRNA|SFMBT1|NM_016329|10,9 | circSFMBT1(10,9) | SFMBT1 | LTGLTTSNSVVLKLLPRGASLRFLMRSTFWWKWMTCVLRTTHGDPLCATPTVLASSLCSGV | LLPRGASLR | No | Alternative | Junction | 9 | 1 | TTG | TGA | riboCIRC,TransCirc | No |
chr3|52943352|52969258|-|3|circRNA|SFMBT1|NM_016329|4,3,2 | circSFMBT1(4,3,2) | SFMBT1 | LRPTGLPPLSLPVSSCSFSAMMAMGRIGEQISGVTSGRLISTPLGGVSRIRRPLKPQKHFHLDPWIPIEQMLETCK | LISTPLGGVSRIR | No | Alternative | Junction | 13 | 2 | CTG | TAA | TransCirc | No |
chr3|53650778|53723999|+|11|circRNA|CACNA1D|ENST00000350061.9|4,5,6,7,8,9,10,11,12,13,14 | circCACNA1D(4,5,6,7,8,9,10,11,12,13,14) | CACNA1D | LGCSCLAASLILMKRKPSGAPLTISLKHFSQCSRKK | KPSGAPLTISLK | No | Alternative | Junction | 12 | 3 | TTG | TAG | TransCirc | No |
chr3|53805146|53808619|+|1|ciRNA|CACNA1D|ENST00000350061.9|45 | ciCACNA1D(45) | CACNA1D | LAVSFLSAGQCLAKDSARSLVCSPSVPGSPPLARPWAFQ | LAVSFLSAGQCLAK | No | Alternative | Alternative | 14 | 1 | CTG | TAG | NA | No |
chr3|53805146|53808619|+|1|ciRNA|CACNA1D|ENST00000350061.9|45 | ciCACNA1D(45) | CACNA1D | LAVSFLSAGQCLAKDSARSLVCSPSVPGSPPLARPWAFQ | LAVSFLSAGQCLAKDSAR | No | Alternative | Alternative | 18 | 1 | CTG | TAG | NA | No |
Page 1 of 1
bottom of page