top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|49032796|49033119|-|1|ciRNA|QRICH1|ENST00000395443.6|7 | ciQRICH1(7) | QRICH1 | LSSEECGSYPRGLLNSSDIYLRNWATESPNPTWLHFIW | GLLNSSDIYLR | No | Alternative | Alternative | 11 | 1 | CTG | TAA | NA | No |
chr3|49283986|49286325|-|4|circRNA|USP4|NM_003363|19,18,17,16 | circUSP4(19,18,17,16) | USP4 | MRKKWSIRKKAKSSFQKQKAVGKMSQEMTPVRPPKRRSKASPAQKGFLPSVL | GFLPSVL | No | Alternative | Alternative | 7 | 1 | ATG | TGA | TransCirc | No |
chr3|49324701|49335596|-|5|circRNA|USP4|NM_003363|6,5,4,3,2 | circUSP4(6,5,4,3,2) | USP4 | LSLKMKMAHGPGRPCSQSILLTAGGSSSGRSMWALTAGTCTMWVNITYFLAQ | MAHGPGRPCSQSILLTAGGSSSGR | No | Junction | Junction | 24 | 2 | TTG | TAG | TransCirc | No |
chr3|49324701|49335596|-|5|circRNA|USP4|NM_003363|6,5,4,3,2 | circUSP4(6,5,4,3,2) | USP4 | LSLKMKMAHGPGRPCSQSILLTAGGSSSGRSMWALTAGTCTMWVNITYFLAQ | MKMAHGPGRPCSQSILLTAGGSSSGR | No | Junction | Junction | 26 | 2 | TTG | TAG | TransCirc | No |
chr3|49510418|49510819|+|1|circRNA|DAG1|ENST00000515359.6|2 | circDAG1(2) | DAG1 | LPPVEISSRLCVLRDGAGVQRVRTQLWDQVTCFLT | DGAGVQR | No | Alternative | Junction | 7 | 1 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page