top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|47706408|47736126|-|6|circRNA|SMARCC1|ENST00000254480.9|10,9,8,7,6,5 | circSMARCC1(10,9,8,7,6,5) | SMARCC1 | MLERGNIRLRLPLRHQQNHGRRVGRKEQLFDQTQHLPHSRH | KEQLFDQTQHLPHSR | No | Junction | Junction | 15 | 2 | ATG | TGA | TransCirc | No |
chr3|47877416|47917174|-|3|circRNA|MAP4|NM_001134364|9,8,7 | circMAP4(9,8,7) | MAP4 | MTSPPHRTRSSHQAQRRKQSSLRASQGDRNGIRREATSTSIGNNDGTEDY | SSHQAQR | Yes | Alternative | Junction | 7 | 1 | ATG | TGA | TransCirc | No |
chr3|47909037|47918841|-|4|circRNA|MAP4|ENST00000426837.6|10,9,8,7 | circMAP4(10,9,8,7) | MAP4 | LPGSLLSCWEALLHGRLLITGWATALCLSQVGSLVHPPVVGLGTKEKVFMLTHLNPRGILAGRPGI | EKVFMLTHLNPR | No | Alternative | Alternative | 12 | 1 | CTG | TAG | NA | No |
chr3|47909037|47918841|-|4|circRNA|MAP4|ENST00000426837.6|10,9,8,7 | circMAP4(10,9,8,7) | MAP4 | MRQLPGFLKSLKREAMKAKAKSLKIIIPHSLLEWRGRKKSLTHLLKGRMEILVVFPIKARK | IIIPHSLLEWR | No | Alternative | Alternative | 11 | 1 | ATG | TAG | NA | No |
chr3|47918718|47921878|-|2|circRNA|MAP4|NM_001134364|6,5 | circMAP4(6,5) | MAP4 | LQHSCCTSGVVCGSLKLSTLRVLCFPRGCCRTSSANGRSL | TSSANGR | No | Alternative | Junction | 7 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page