top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|143292299|143292698|+|2|circRNA|CASP2|ENST00000310447.9|3,4 | circCASP2(3,4) | CASP2 | LSPLQEAPPVDRPKWAVSARMWNSSTCCLRGVPKLLMPSVKH | LLMPSVKH | No | Alternative | Junction | 8 | 3 | CTG | TGA | TransCirc | No |
chr7|143857099|143863796|-|6|circRNA|TCAF1|NM_001206941|7,6,5,4,3,2 | circTCAF1(7,6,5,4,3,2) | TCAF1 | LAGWGPQRQGCGADRAENPEWPPRSGGHRHQHRAQSDQ | AENPEWPPRSGGHR | No | Alternative | Alternative | 14 | 3 | CTG | TGA | NA | No |
chr7|143857099|143863796|-|6|circRNA|TCAF1|NM_001206941|7,6,5,4,3,2 | circTCAF1(7,6,5,4,3,2) | TCAF1 | LLEPKPGGGPSRTPECPLWLDSQETSSSTPLASALQAKASIQGPFVLLKQG | ASIQGPFVLLK | No | Alternative | Alternative | 11 | 2 | TTG | TAA | NA | No |
chr7|143857099|143863796|-|6|circRNA|TCAF1|NM_001206941|7,6,5,4,3,2 | circTCAF1(7,6,5,4,3,2) | TCAF1 | LLEPKPGGGPSRTPECPLWLDSQETSSSTPLASALQAKASIQGPFVLLKQG | ASIQGPFVLLKQG | No | Alternative | Alternative | 13 | 2 | TTG | TAA | NA | No |
chr7|143857099|143863796|-|6|circRNA|TCAF1|NM_001206941|7,6,5,4,3,2 | circTCAF1(7,6,5,4,3,2) | TCAF1 | LLEPKPGGGPSRTPECPLWLDSQETSSSTPLASALQAKASIQGPFVLLKQG | LLEPKPGGGPSR | No | Alternative | Alternative | 12 | 2 | TTG | TAA | NA | No |
Page 1 of 1
bottom of page