top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr9|136898928|136899559|+|1|ciRNA|TRAF2|ENST00000419057.5|3 | ciTRAF2(3) | TRAF2 | LSYCSRCPWRFRRAFLTNGVIKTVCCEYWGLKHVLLTFACCWFH | AFLTNGVIK | No | Alternative | Alternative | 9 | 2 | CTG | TAA | NA | No |
chr9|137021890|137023052|-|4|circRNA|ABCA2|ENST00000341511.10|7,6,5,4 | circABCA2(7,6,5,4) | ABCA2 | LLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEPSTQRRP | LGGNPLFRMEPSTQR | No | Junction | Junction | 15 | 1 | CTG | TGA | TransCirc | No |
chr9|137078049|137079148|+|3|circRNA|UAP1L1|ENST00000409858.7|2,3,4 | circUAP1L1(2,3,4) | UAP1L1 | LCTCTVWTTSWCGWRTLSSSASVCCRAQTVAPRFPSDFSEQGGRPAAGWGAGHSPGRDLPQGYVPCGAAQPEDPVPAAGGADSAGGAAGR | AQTVAPR | No | Alternative | Junction | 7 | 1 | TTG | TGA | NA | No |
chr9|137272222|137272481|+|1|ciRNA|NELFB|ENST00000343053.4|11 | ciNELFB(11) | NELFB | LRGGCCPQPGAEGPQVGLLGTRARMWPCRVPGHSWGGSQRLAMSCLQGPWPPASGLGLGRQQGLPPA | LAMSCLQGPWPPASGLGLGR | No | Alternative | Alternative | 20 | 3 | CTG | TAG | NA | No |
chr9|137297256|137298789|+|2|circRNA|Unknown|T370099|2,3 | circUnknown(2,3).J | Unknown | LWPLSFPTAGHSRAGPGQDFPKPASGSWPISQADSAG | LWPLSFPTAGHSR | No | Alternative | Alternative | 13 | 2 | TTG | TAG | NA | No |
Page 1 of 1
bottom of page