top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr9|120824493|120833456|-|6|circRNA|PSMD5|ENST00000210313.7|7,6,5,4,3,2 | circPSMD5(7,6,5,4,3,2) | PSMD5 | LESWDPMLKENRFYRKQGKDYFVCIHSGEIAPSYGTGSRGPEPQG | QGKDYFVCIHSGEIAPSYGTGSR | No | Alternative | Junction | 23 | 1 | TTG | TGA | TransCirc | No |
chr9|120960247|120963738|-|5|circRNA|C5|ENST00000223642.2|38,37,36,35,34 | circC5(38,37,36,35,34) | C5 | LQRQENKQHVNQRLHMLQAQQGRIIIWILSCGDGHLLAYWNQCK | LHMLQAQQGR | No | Junction | Junction | 10 | 1 | CTG | TGA | TransCirc | No |
chr9|120980082|120981939|-|2|circRNA|C5|ENST00000223642.2|28,27 | circC5(28,27) | C5 | LTTFCLKIHCQPRAPLHWPFLRMLFPWEIKLTHSFVQLFQL | MLFPWEIK | No | Alternative | Alternative | 8 | 2 | CTG | TGA | TransCirc | No |
chr9|122853951|122865657|-|9|circRNA|RC3H2|ENST00000373670.5|17,16,15,14,13,12,11,10,9 | circRC3H2(17,16,15,14,13,12,11,10,9) | RC3H2 | LAMQQKWNSLDEGRHLTLNLLSKEIELRNGEVSIKEQKDQCHCKNVSSSK | NGEVSIK | No | Alternative | Junction | 7 | 1 | TTG | TAA | TransCirc | No |
chr9|122865348|122883379|-|6|circRNA|RC3H2|ENST00000373670.5|9,8,7,6,5,4 | circRC3H2(9,8,7,6,5,4) | RC3H2 | LETVKKVGKVGANGQNAAGPSADSVTENYARRGLEAGVTGIRRWFCPLKESSGTFCCAETRTKISSGIKNKYWSCCATTVSSFLF | GLEAGVTGIR | No | Alternative | Junction | 10 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page