top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr9|114381059|114381446|-|1|circRNA|AKNA|NM_030767|2 | circAKNA(2) | AKNA | LRSAGLSLAWGRAPSGGAGPGPRTRGMWIEVVHKAGKKRDSFPMPPAPSS | APSGGAGPGPRTR | No | Alternative | Alternative | 13 | 1 | CTG | TAG | TransCirc | No |
chr9|114423313|114426413|-|4|circRNA|DFNB31|ENST00000265134.10|7,6,5,4 | circDFNB31(7,6,5,4) | DFNB31 | LGTPTPWSPTVTRVHPQAATAPPPPSARPGLGTRF | LGTPTPWSPTVTR | No | Alternative | Junction | 13 | 2 | CTG | TAG | TransCirc | No |
chr9|115038260|115060002|-|7|circRNA|TNC|NM_002160|20,19,18,17,16,15,14 | circTNC(20,19,18,17,16,15,14) | TNC | LRLAGMASDSTGPQLTMPMSTLSFRCRRSTKWRQPRTSRCLAASGLWTSRASRLPRLIESPSMG | CLAASGLWTSRASR | No | Alternative | Alternative | 14 | 1 | CTG | TGA | NA | No |
chr9|115038260|115060002|-|7|circRNA|TNC|NM_002160|20,19,18,17,16,15,14 | circTNC(20,19,18,17,16,15,14) | TNC | LRLAGMASDSTGPQLTMPMSTLSFRCRRSTKWRQPRTSRCLAASGLWTSRASRLPRLIESPSMG | LAGMASDSTGPQLTMPMSTLSFR | No | Alternative | Alternative | 23 | 1 | CTG | TGA | NA | No |
chr9|116187153|116235637|+|6|circRNA|PAPPA|NM_002581|2,3,4,5,6,7 | circPAPPA(2,3,4,5,6,7) | PAPPA | LMLNSPVSPVSAPGAQIQLSTHTRFLQPALSLKAATSSWSSSTPWSLSL | AATSSWSSSTPWSLSL | No | Alternative | Alternative | 16 | 1 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page