top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|65714494|65714910|+|2|circRNA|KAT5|ENST00000377046.7|8,9 | circKAT5(8,9) | KAT5 | MRFTARAPSPSLRLMDVRTRTPRTALMEYRQHHA | APSPSLR | No | Alternative | Junction | 7 | 2 | ATG | TGA | NA | No |
chr11|6608393|6608967|+|3|circRNA|ILK|ENST00000532063.5|3,4,5 | circILK(3,4,5) | ILK | MGQNLNRIPYKDTFWKGTTRTRPPIAVQGRHQCSE | TRPPIAVQGR | No | Junction | Junction | 10 | 3 | ATG | TGA | NA | No |
chr11|6618855|6619255|+|1|ciRNA|RP11-732A19.9|ENST00000545572.1|1 | ciRP11-732A19.9(1) | RP11-732A19.9 | LVGLRAVTAFAREDEGKGETQLFLRVRTAQGHPAWGQPVGSGVRDMALVRVEMENIGHGRFQIRS | AVTAFAR | No | Alternative | Junction | 7 | 1 | CTG | TGA | NA | No |
chr11|66193485|66211259|+|3|circRNA|PACS1|NM_018026|2,3,4 | circPACS1(2,3,4) | PACS1 | LQIMLQRRKRYKNRTILGYKTLAVGLINMAEAIQLDPEETRHAKRNGQRS | AIQLDPEETR | No | Alternative | Junction | 10 | 1 | CTG | TAA | TransCirc | No |
chr11|6639816|6641733|-|1|circRNA|DCHS1|ENST00000299441.4|2 | circDCHS1(2) | DCHS1 | MIMSPNSRGLSTMPHCLRAPSLELASCRSGSLSWSQGPSGT | GLSTMPHCLR | No | Alternative | Junction | 10 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page