top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|62629813|62630836|-|4|circRNA|GANAB|ENST00000532402.5|13,12,11,10 | circGANAB(13,12,11,10) | GANAB | MNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVEPRRCPHSSPSATTRAVGTTGTRLMCWKWIRALMITTCPVMSSG | ALMITTCPVMSSG | No | Alternative | Junction | 13 | 1 | ATG | TAG | TransCirc | No |
chr11|62839113|62839659|-|3|circRNA|WDR74|NM_018093|4,3,2 | circWDR74(4,3,2) | WDR74 | LRGQDGEALQHRGWHIPGSETLPGRGGHVPWPRPGRRQLHCAASDSTPAGDAHAAPEV | GGHVPWPRPGR | No | Alternative | Junction | 11 | 3 | CTG | TGA | TransCirc | No |
chr11|62839113|62839659|-|3|circRNA|WDR74|NM_018093|4,3,2 | circWDR74(4,3,2) | WDR74 | MAYSRVRDTARAGRACSVASPRPTATTLRCIGLDARW | DTARAGR | No | Alternative | Junction | 7 | 2 | ATG | TGA | TransCirc | No |
chr11|62839113|62839867|-|3|circRNA|WDR74|ENST00000525239.5|4,3,2 | circWDR74(4,3,2).A | WDR74 | MAYSRVRDTARAGRACSVASPRPTVQNTYYIMEPGDRLGLA | ACSVASPRPTVQNTYYIMEPGDRLGLA | No | Junction | Junction | 27 | 2 | ATG | TGA | TransCirc | No |
chr11|62839113|62839867|-|3|circRNA|WDR74|ENST00000525239.5|4,3,2 | circWDR74(4,3,2).A | WDR74 | MLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGPEHILHNGAGRQTRAGLIRPRSPGKVLFTPKCKMINVFFRST | GLAQADGPEHILHNGAGR | No | Junction | Junction | 18 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page