top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|35189972|35209987|+|1|ciRNA|CD44|ENST00000526000.5|4 | ciCD44(4) | CD44 | MKKMKMKETDTSVFLDQALMMMKILSPAPVRIINYSTAIYARLID | ETDTSVFLDQALMMMK | Yes | Alternative | Alternative | 16 | 1 | ATG | TAA | NA | No |
chr11|35189972|35209987|+|1|ciRNA|CD44|ENST00000526000.5|4 | ciCD44(4) | CD44 | MLSHFIDLYSCFISYSLLAKMQSFGGGMVLCGLLQPRV | MQSFGGGMVLCGLLQPRV | Yes | Alternative | Alternative | 18 | 1 | ATG | TGA | NA | No |
chr11|35189972|35209987|+|1|ciRNA|CD44|ENST00000526000.5|4 | ciCD44(4) | CD44 | MSLHMAAGALRTPMGENQARQRSSESILILCTDEEKEIPLN | MSLHMAAGALR | Yes | Alternative | Alternative | 11 | 1 | ATG | TAA | NA | No |
chr11|35189972|35209987|+|1|ciRNA|CD44|ENST00000526000.5|4 | ciCD44(4) | CD44 | MSLHMAAGALRTPMGENQARQRSSESILILCTDEEKEIPLN | TPMGENQARQR | Yes | Alternative | Alternative | 11 | 1 | ATG | TAA | NA | No |
chr11|35189972|35209987|+|1|ciRNA|CD44|ENST00000526000.5|4 | ciCD44(4) | CD44 | MVPEPAHFVFSPCVRLHVSIKKAMFLSLCKIWVFHHALMWSPSRLSKNKHTA | MVPEPAHFVFSPCVR | Yes | Alternative | Alternative | 15 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page