top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|94526222|94531085|-|3|circRNA|KIAA1429|ENST00000297591.9|8,7,6 | circKIAA1429(8,7,6) | KIAA1429 | MGNSFRRNSKFNNKRVKLFAIEKHKTRLPWPVGRLDHASFKFTSSASPTYRLKCSTAQSWDQISVLTSRMWGSRSYRTATSRSDQWII | MGNSFRR | No | Alternative | Alternative | 7 | 2 | ATG | TGA | TransCirc | No |
chr8|94671452|94692827|+|4|circRNA|ESRP1|ENST00000423620.6|11,12,13,14 | circESRP1(11,12,13,14) | ESRP1 | LATSLQLLILAVSLHSLARWSECRAWPTILELRKFLTSSKVTRC | AWPTILELR | No | Alternative | Junction | 9 | 3 | TTG | TGA | TransCirc | No |
chr8|94734629|94761834|+|6|circRNA|DPY19L4|NM_181787|3,4,5,6,7,8 | circDPY19L4(3,4,5,6,7,8) | DPY19L4 | LLMSASTYTFMMMWEYSHYLLFLQAISLFLLDTFSVEQSDKMYYFNALQRFSLAVLQRLLVV | MYYFNALQR | No | Alternative | Junction | 9 | 1 | TTG | TGA | TransCirc | No |
chr8|94761699|94777786|+|7|circRNA|DPY19L4|NM_181787|8,9,10,11,12,13,14 | circDPY19L4(8,9,10,11,12,13,14) | DPY19L4 | LDSLCVHVSSIWCMFSRTLDDTFQVASIKNCTPNIVEVLLLVDECFNLHIYDDVGV | LDSLCVHVSSIWCMFSR | No | Alternative | Junction | 17 | 1 | CTG | TAG | TransCirc | No |
chr8|94842346|94856978|+|6|circRNA|INTS8|NM_017864|10,11,12,13,14,15 | circINTS8(10,11,12,13,14,15) | INTS8 | LELVTEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPEMKL | GYLEMRLPEMK | No | Junction | Junction | 11 | 1 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page