top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|121543547|121559657|+|9|circRNA|SORL1|ENST00000260197.11|13,14,15,16,17,18,19,20,21 | circSORL1(13,14,15,16,17,18,19,20,21) | SORL1 | MEILANQLTGLMDMKIFYKGKNTDTVPMKGRPGKHSSSLRSQCLCMASSQNLGRRALSSPSLARTKRMSTAG | RALSSPSLAR | No | Alternative | Junction | 10 | 1 | ATG | TGA | TransCirc | No |
chr11|121543547|121559657|+|9|circRNA|SORL1|ENST00000260197.11|13,14,15,16,17,18,19,20,21 | circSORL1(13,14,15,16,17,18,19,20,21) | SORL1 | MEILANQLTGLMDMKIFYKGKNTDTVPMKGRPGKHSSSLRSQCLCMASSQNLGRRALSSPSLARTKRMSTAG | SQCLCMASSQNLGR | No | Alternative | Junction | 14 | 1 | ATG | TGA | TransCirc | No |
chr11|121604192|121615055|+|9|circRNA|SORL1|ENST00000260197.11|33,34,35,36,37,38,39,40,41 | circSORL1(33,34,35,36,37,38,39,40,41) | SORL1 | LHLASRPKPSTRLQWNVPGPAPGMCHTQHLDLHEQGVPVRGRGGLHCALGALRRLPGLLGRER | GGLHCALGALR | No | Alternative | Junction | 11 | 1 | CTG | TGA | TransCirc | No |
chr11|121606844|121607290|+|2|circRNA|SORL1|ENST00000260197.11|36,37 | circSORL1(36,37) | SORL1 | MWASQRAASNFTEIKNLLVNTLYTVRCQMPLEISSCHSPGKQKV | CQMPLEISSCHSPGK | No | Alternative | Junction | 15 | 1 | ATG | TGA | TransCirc | No |
chr11|122776218|122779695|+|3|circRNA|UBASH3B|ENST00000284273.5|2,3,4 | circUBASH3B(2,3,4) | UBASH3B | MPWGKPCRPRSVAGNVSSRPRCPWSSIRRPTSSASL | SVAGNVSSRPR | No | Alternative | Alternative | 11 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page