top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|10461514|10461740|+|1|circRNA|AMPD3|ENST00000532250.5|3 | circAMPD3(3) | AMPD3 | LPHRAKGSQGEGAAEGAGRAEVCGDRKKLRCRGSFPS | AKGSQGEGAAEGAGR | No | Alternative | Junction | 15 | 2 | CTG | TGA | TransCirc | No |
chr11|10461514|10482225|+|2|circRNA|AMPD3|ENST00000444303.6|2,3 | circAMPD3(2,3).A | AMPD3 | MRGSPTTASRGSHPSTWVIRGRILHLRKRAFQLRCRGSFPS | AFQLRCR | No | Junction | Junction | 7 | 2 | ATG | TGA | NA | No |
chr11|10461514|10482225|+|2|circRNA|AMPD3|ENST00000444303.6|2,3 | circAMPD3(2,3).A | AMPD3 | MRGSPTTASRGSHPSTWVIRGRILHLRKRAFQLRCRGSFPS | GSHPSTWVIRGR | No | Alternative | Junction | 12 | 2 | ATG | TGA | NA | No |
chr11|10461514|10482225|+|2|circRNA|AMPD3|ENST00000444303.6|2,3 | circAMPD3(2,3).A | AMPD3 | MRGSPTTASRGSHPSTWVIRGRILHLRKRAFQLRCRGSFPS | GSPTTASR | No | Alternative | Junction | 8 | 2 | ATG | TGA | NA | No |
chr11|10461514|10482225|+|2|circRNA|AMPD3|ENST00000444303.6|2,3 | circAMPD3(2,3).A | AMPD3 | MRGSPTTASRGSHPSTWVIRGRILHLRKRAFQLRCRGSFPS | GSPTTASRGSHPSTWVIR | No | Alternative | Junction | 18 | 2 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page