top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|8376246|8381834|-|2|circRNA|SGK223|ENST00000615670.4|3,2 | circSGK223(3,2) | SGK223 | LLEGPQCHRWLTLVMGALAAAALGPSLHPKVLLTPLLPAGPTVSLSVTHPGVPSLPPRQPRNRGGPGSRQAPGVVSAG | GGPGSRQAPGVVSAG | No | Alternative | Alternative | 15 | 2 | CTG | TAG | NA | No |
chr8|89611433|89617156|-|3|circRNA|RP11-37B2.1|TCONS_l2_00028293|4,3,2 | circRP11-37B2.1(4,3,2) | RP11-37B2.1 | LLTQHDSASVLPLTHGAPNRGELVSQIDWKTNPHEARKRNEAAVAESIAGLNDAG | NEAAVAESIAGLNDAG | No | Alternative | Alternative | 16 | 2 | TTG | TAG | NA | No |
chr8|9002680|9020464|+|6|circRNA|ERI1|ENST00000523898.5|2,3,4,5,6,7 | circERI1(2,3,4,5,6,7) | ERI1 | LRRWRSAHAGSLRLPGVWTPHAPGSGRWPLEFVWPPPREREPGNFSTEKGEAFGLCRVRVSKCPAPATLLWRDSRHGGSTE | SAHAGSLR | No | Alternative | Alternative | 8 | 3 | CTG | TAA | NA | No |
chr8|9007969|9020464|+|5|circRNA|ERI1|ENST00000523898.5|3,4,5,6,7 | circERI1(3,4,5,6,7) | ERI1 | LRKSGSIFGSHMEIFTRKLNSVNLMARRQKDPSSLPPVRVTSVTRFTKRLPLRMAVLIE | DPSSLPPVR | No | Alternative | Junction | 9 | 3 | TTG | TGA | NA | No |
chr8|9007969|9020464|+|5|circRNA|ERI1|ENST00000523898.5|3,4,5,6,7 | circERI1(3,4,5,6,7) | ERI1 | LRKSGSIFGSHMEIFTRKLNSVNLMARRQKDPSSLPPVRVTSVTRFTKRLPLRMAVLIE | LNSVNLMAR | No | Alternative | Junction | 9 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page