top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|95058334|95067357|-|3|circRNA|CYP2C8|ENST00000535898.5|4,3,2 | circCYP2C8(4,3,2) | CYP2C8 | LDVNNPRDFIDCFLIKMEQESFPAMERDGRRSGVSPSQPCGILGWGRGALRTVFKRKLTALWRS | RSGVSPSQPCGILGWGR | No | Alternative | Junction | 17 | 1 | CTG | TGA | TransCirc | No |
chr10|95339132|95346452|-|4|circRNA|SORBS1|ENST00000371227.8|27,26,25,24 | circSORBS1(27,26,25,24) | SORBS1 | LVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPTDETCQSQI | EDPGDIPTR | No | Alternative | Junction | 9 | 3 | CTG | TGA | TransCirc | No |
chr10|95339132|95346452|-|4|circRNA|SORBS1|ENST00000371227.8|27,26,25,24 | circSORBS1(27,26,25,24) | SORBS1 | LVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPTDETCQSQI | EDPGDIPTRHLPHHLR | No | Alternative | Junction | 16 | 3 | CTG | TGA | TransCirc | No |
chr10|95339132|95410777|-|18|circRNA|SORBS1|ENST00000371227.8|27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10 | circSORBS1(27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10) | SORBS1 | LVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPTGFQSSTK | SQCHCKPTGFQSSTK | No | Junction | Junction | 15 | 3 | CTG | TGA | TransCirc | No |
chr10|95375972|95399189|-|6|circRNA|SORBS1|ENST00000371227.8|17,16,15,14,13,12 | circSORBS1(17,16,15,14,13,12) | SORBS1 | MNLGINSFRNWSLGNRSCLRKKSGRAGLSTNPGKTHLTWQGY | NWSLGNRSCLR | No | Junction | Junction | 11 | 2 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page