top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|91939951|91966757|+|12|circRNA|BTAF1|ENST00000265990.10|3,4,5,6,7,8,9,10,11,12,13,14 | circBTAF1(3,4,5,6,7,8,9,10,11,12,13,14) | BTAF1 | LAFFASHYIISSKSSIGNSVYVIINTGPGVDIFKECKLGYPDCSRTSC | SSIGNSVYVIINTGPGVDIFKECK | No | Junction | Junction | 24 | 1 | CTG | TGA | TransCirc | No |
chr10|91994534|91997751|+|3|circRNA|BTAF1|ENST00000265990.10|23,24,25 | circBTAF1(23,24,25) | BTAF1 | MEQLDVGIVPYIVLLVVPVLGRMSDQTDSVRFMATQCFATLIRLMPLEMENPSWIREIALLKNW | FMATQCFATLIRLMPLEMENPSWIR | No | Junction | Junction | 25 | 3 | ATG | TGA | TransCirc | No |
chr10|91994534|92008275|+|4|circRNA|BTAF1|ENST00000265990.10|23,24,25,26 | circBTAF1(23,24,25,26) | BTAF1 | MSAELIQLKAKERHFLEQLLDGKKLENYKIPVPINAELRKYQQMENPSWIREIALLKNW | YQQMENPSWIR | No | Junction | Junction | 11 | 1 | ATG | TGA | TransCirc | No |
chr10|91994534|92014029|+|10|circRNA|BTAF1|ENST00000265990.10|23,24,25,26,27,28,29,30,31,32 | circBTAF1(23,24,25,26,27,28,29,30,31,32) | BTAF1 | MDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQMENPSWIREIALLKNW | IIQDYYCTLSPLQMENPSWIR | No | Junction | Junction | 21 | 3 | ATG | TGA | TransCirc | No |
chr10|92081319|92091944|-|2|circRNA|CPEB3|ENST00000412050.8|9,8 | circCPEB3(9,8) | CPEB3 | LAAWHSPISRVTLQPSALVLCSFSTMTLTNGCKFDHGT | LAAWHSPISR | No | Alternative | Junction | 10 | 1 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page