top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|46554695|46556053|-|1|ciRNA|GPRIN2|NM_014696|1 | ciGPRIN2(1) | GPRIN2 | MLPAALPRVGPECSYQAPFTLGWIKPPPGGCCIPTVQWGFVLCAFLPGP | MLPAALPR | No | Alternative | Alternative | 8 | 1 | ATG | TGA | NA | No |
chr10|49857305|49934163|-|11|circRNA|PARG|NM_001303486|13,12,11,10,9,8,7,6,5,4,3 | circPARG(13,12,11,10,9,8,7,6,5,4,3) | PARG | LRRKVNPSHRWMWIILKIVVKTQKQMRRQVQVLMNKKMVVPPKQQINLQGSKQETLTLNLGNGTLLRAVKLDYISNLKEERVALE | KVNPSHR | No | Alternative | Alternative | 7 | 1 | TTG | TGA | riboCIRC | No |
chr10|50078692|50084167|+|1|ciRNA|FAM21A|ENST00000434114.6|4 | ciFAM21A(4) | FAM21A | LPQSPLTRKRYHCQRAMPHRGQGSISFSSGGRRLCKGGALS | AMPHRGQGSISFSSGGR | No | Alternative | Alternative | 17 | 1 | CTG | TGA | NA | No |
chr10|50327204|50344345|-|2|circRNA|SGMS1|NM_147156|8,7 | circSGMS1(8,7) | SGMS1 | LPRESWGLPAVCQYNEGSGLLVTQEGGRLAAGECYARIL | LAAGECYARIL | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr10|5648969|5653050|-|3|circRNA|ASB13|NM_024701|4,3,2 | circASB13(4,3,2) | ASB13 | LTSGPIWKRTIAILGPLCTLPVPGSIWTVSKCCSMQVSGWSGPLCTRQPSGVRACSCNS | RTIAILGPLCTLPVPGSIWTVSK | No | Alternative | Junction | 23 | 1 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page