top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|78798208|78804912|-|1|ciRNA|IL7|ENST00000263851.8|1 | ciIL7(1) | IL7 | LLSVLRGNAAASAPLSGGSPQPVSEAAKGSLSGALPVLLAAPSYSRRRPGFGE | GSLSGALPVLLAAPSYSRR | No | Alternative | Alternative | 19 | 1 | CTG | TAG | NA | No |
chr8|78798208|78804912|-|1|ciRNA|IL7|ENST00000263851.8|1 | ciIL7(1) | IL7 | LSNLGKRSSPLRTSSRARRAGAIPDALGAPAPRQVRE | AGAIPDALGAPAPR | No | Alternative | Junction | 14 | 2 | CTG | TAG | NA | No |
chr8|78798208|78804912|-|1|ciRNA|IL7|ENST00000263851.8|1 | ciIL7(1) | IL7 | MGELGTYEMWVQGPRYVCSIVREAISDLKSFCIWRTR | MGELGTYEMWVQGPR | No | Alternative | Alternative | 15 | 1 | ATG | TAG | NA | No |
chr8|80499493|80500382|+|1|circRNA|ZBTB10|ENST00000379091.8|2 | circZBTB10(2) | ZBTB10 | LLSNAATCCLSRRKYTTHQGRTRSQKYHQRRGTVTLIVGQMRTLIAINFCDN | GTVTLIVGQMR | No | Alternative | Junction | 11 | 3 | TTG | TAA | TransCirc | No |
chr8|80499493|80500382|+|1|circRNA|ZBTB10|ENST00000379091.8|2 | circZBTB10(2) | ZBTB10 | LLSNAATCCLSRRKYTTHQGRTRSQKYHQRRGTVTLIVGQMRTLIAINFCDN | LLSNAATCCLSRR | No | Alternative | Junction | 13 | 3 | TTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page