top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|124681606|124682379|-|2|rescued|ENSG00000258539|ENST00000494792|33,141|0,632 | NA | ENSG00000258539 | MAQKMTDGETWTGNALFRLTNRAPASGNACLKRTAHYGTGRQ | APASGNACLK | Yes | Alternative | Junction | 10 | 1 | ATG | TGA | riboCIRC,TransCirc | No |
chr10|124681606|124682379|-|2|rescued|ENSG00000258539|ENST00000494792|33,141|0,632 | NA | ENSG00000258539 | MAQKMTDGETWTGNALFRLTNRAPASGNACLKRTAHYGTGRQ | APASGNACLKR | Yes | Alternative | Junction | 11 | 1 | ATG | TGA | riboCIRC,TransCirc | No |
chr10|124681606|124706887|-|3|circRNA|RP11-12J10.3|ENST00000494792.1|9,8,7 | circRP11-12J10.3(9,8,7) | RP11-12J10.3 | LAISQKGPTPRVSGQWGAVSADINSPGGTHPKSAQVKMADTHPGMEPSA | GPTPRVSGQWGAVSADINSPGGTHPK | No | Alternative | Alternative | 26 | 2 | TTG | TGA | NA | No |
chr10|124816575|124826785|+|3|circRNA|FAM175B|ENST00000298492.5|3,4,5 | circFAM175B(3,4,5) | FAM175B | LGGTDSGAIRSSRCPTESRFFTSSSPASSACPTSSFFSSASSPLPTIPLTL | LGGTDSGAIR | No | Alternative | Alternative | 10 | 2 | TTG | TAG | TransCirc | No |
chr10|124816575|124826785|+|3|circRNA|FAM175B|ENST00000298492.5|3,4,5 | circFAM175B(3,4,5) | FAM175B | LGGTDSGAIRSSRCPTESRFFTSSSPASSACPTSSFFSSASSPLPTIPLTL | LGGTDSGAIRSSR | No | Alternative | Alternative | 13 | 2 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page