top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|102654652|102656385|+|4|circRNA|TRIM8|NM_030912|2,3,4,5 | circTRIM8(2,3,4,5) | TRIM8 | LNSKLFLNEVAKKEKQLRKMLEEDAHEAAGPAGGARAGH | KMLEEDAHEAAGPAGGAR | No | Junction | Junction | 18 | 2 | CTG | TGA | TransCirc | No |
chr10|103378234|103380019|+|3|circRNA|TAF5|ENST00000369839.3|3,4,5 | circTAF5(3,4,5) | TAF5 | LKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQVPWRSGMLLPG | LGPDCLPSICFYTFLNAYQVPWRSGMLLPG | No | Junction | Junction | 30 | 2 | TTG | TGA | TransCirc | No |
chr10|103433947|103434975|+|3|circRNA|PDCD11|ENST00000369797.7|23,24,25 | circPDCD11(23,24,25) | PDCD11 | MGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVSTMW | IGTVSIFHMSDSYSETPLEDFVPQKVVSTMW | No | Junction | Junction | 31 | 3 | ATG | TGA | TransCirc | No |
chr10|1072115|1078003|+|2|circRNA|WDR37|ENST00000358220.5|2,3 | circWDR37(2,3) | WDR37 | LPSSVRSTLLELFGQIEREFENLYIENLESYCRSDQDTTS | EFENLYIENLESYCRSDQDTTS | No | Junction | Junction | 22 | 1 | CTG | TAG | TransCirc | No |
chr10|1072115|1080476|+|4|circRNA|WDR37|ENST00000358220.5|2,3,4,5 | circWDR37(2,3,4,5) | WDR37 | LKTTYKASTSKLIAGVTRTLPPRSNAHRKRKLFDCSPNKTEAQIP | LIAGVTR | No | Alternative | Junction | 7 | 3 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page