top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|31425913|31426652|+|1|ciRNA|SERINC2|ENST00000373710.5|6 | ciSERINC2(6) | SERINC2 | LTWRGLGGVLFGGSCRVGHTQPVVWDALLVVPRLNFK | GLGGVLFGGSCR | No | Alternative | Alternative | 12 | 1 | CTG | TGA | NA | No |
chr1|31425913|31426652|+|1|ciRNA|SERINC2|ENST00000373710.5|6 | ciSERINC2(6) | SERINC2 | LVLSVLNTTRRKAHLGAVWFPHLPRLASISQTGRAGQQPVPRSVFARLF | LASISQTGR | No | Alternative | Alternative | 9 | 2 | CTG | TGA | NA | No |
chr1|31730799|31742217|-|22|circRNA|ADGRB2|NM_001294335|29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8 | circADGRB2(29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8) | ADGRB2 | LAVGVEVVRMPPGPGRRGPPGELPRQWPTLKATPASCPWTTRAWGWALPMDLSRIPME | AWGWALPMDLSR | No | Alternative | Alternative | 12 | 1 | CTG | TGA | TransCirc | No |
chr1|31730799|31742217|-|22|circRNA|ADGRB2|NM_001294335|29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8 | circADGRB2(29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8) | ADGRB2 | LAVGVEVVRMPPGPGRRGPPGELPRQWPTLKATPASCPWTTRAWGWALPMDLSRIPME | LAVGVEVVRMPPGPGR | No | Alternative | Alternative | 16 | 1 | CTG | TGA | TransCirc | No |
chr1|32037834|32038619|+|2|circRNA|KHDRBS1|NM_001271878|5,6 | circKHDRBS1(5,6) | KHDRBS1 | MMIHTQNKVTKATKAITARVKGAVVLDHLGGLWYVVHQ | ATKAITAR | No | Alternative | Junction | 8 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page