top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|246849614|246851442|-|1|circRNA|AHCTF1|ENST00000470300.5|24 | circAHCTF1(24) | AHCTF1 | LSQVILHHLMCYLKQLTQQLKKNLYAVGKMIIMDKLQICHLP | LSQVILHHLMCYLK | No | Alternative | Alternative | 14 | 2 | TTG | TAA | TransCirc | No |
chr1|246849614|246851442|-|1|circRNA|AHCTF1|ENST00000470300.5|24 | circAHCTF1(24) | AHCTF1 | MSNQHNRKHQQMLLLLRCQGSQSGRKLGRQKKFLKLLKTSILMSEDYLRTSKYLKILLRLGEEGERKKLIRTY | KHQQMLLLLR | No | Alternative | Alternative | 10 | 2 | ATG | TAG | TransCirc | No |
chr1|246898207|246918377|-|11|circRNA|AHCTF1|ENST00000366508.5|12,11,10,9,8,7,6,5,4,3,2 | circAHCTF1(12,11,10,9,8,7,6,5,4,3,2) | AHCTF1 | LTFLKKSGPSLNELIPDGYNRCLVAGLLSPRFVDVQPSSLSQWKYARLKSSSD | FVDVQPSSLSQWKYAR | No | Junction | Junction | 16 | 1 | TTG | TAG | TransCirc | No |
chr1|246905540|246918377|-|5|circRNA|AHCTF1|ENST00000366508.5|6,5,4,3,2 | circAHCTF1(6,5,4,3,2) | AHCTF1 | LYMLSLFKNLRMILGIAVTCGLFSLHKIVEVCET | MILGIAVTCGLFSLHK | No | Alternative | Junction | 16 | 3 | CTG | TAA | TransCirc | No |
chr1|248850681|248855946|-|5|circRNA|ZNF692|NM_001136036|11,10,9,8,7 | circZNF692(11,10,9,8,7) | ZNF692 | LSSTDVSTLEKNPCIVSLMPPDYCLPLSPAHLKRGRHHQPLQHSPVLLLCRPCQHPH | LSSTDVSTLEK | No | Alternative | Junction | 11 | 1 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page