top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|243156220|243191494|-|7|circRNA|CEP170|ENST00000366542.5|14,13,12,11,10,9,8 | circCEP170(14,13,12,11,10,9,8) | CEP170 | MPSKLRNNLQLQMKKYFFLSVGNQVILKSLQKNSSNHHK | KYFFLSVGNQVILK | No | Alternative | Alternative | 14 | 2 | ATG | TAA | TransCirc | No |
chr1|243156220|243191494|-|7|circRNA|CEP170|ENST00000366542.5|14,13,12,11,10,9,8 | circCEP170(14,13,12,11,10,9,8) | CEP170 | MPSKLRNNLQLQMKKYFFLSVGNQVILKSLQKNSSNHHK | LRNNLQLQMK | No | Alternative | Alternative | 10 | 2 | ATG | TAA | TransCirc | No |
chr1|243156220|243191494|-|7|circRNA|CEP170|ENST00000366542.5|14,13,12,11,10,9,8 | circCEP170(14,13,12,11,10,9,8) | CEP170 | MPSKLRNNLQLQMKKYFFLSVGNQVILKSLQKNSSNHHK | NNLQLQMK | No | Alternative | Alternative | 8 | 2 | ATG | TAA | TransCirc | No |
chr1|243156220|243191494|-|7|circRNA|CEP170|ENST00000366542.5|14,13,12,11,10,9,8 | circCEP170(14,13,12,11,10,9,8) | CEP170 | MPSKLRNNLQLQMKKYFFLSVGNQVILKSLQKNSSNHHK | NNLQLQMKK | No | Alternative | Alternative | 9 | 2 | ATG | TAA | TransCirc | No |
chr1|243164283|243166116|-|1|circRNA|CEP170|ENST00000366542.5|13 | circCEP170(13) | CEP170 | LALQLPWLAREREGDELFPSFQMKKSLLRATEQRL | LALQLPWLARER | No | Alternative | Alternative | 12 | 1 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page