top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|55941854|55953984|+|7|circRNA|LYN|ENST00000519728.5|2,3,4,5,6,7,8 | circLYN(2,3,4,5,6,7,8) | LYN | MACAEDWRRLVLVPSHRSHGIKMPGRSPGSPSSW | LVLVPSHR | No | Alternative | Alternative | 8 | 1 | ATG | TGA | NA | No |
chr8|55941854|55953984|+|7|circRNA|LYN|ENST00000519728.5|2,3,4,5,6,7,8 | circLYN(2,3,4,5,6,7,8) | LYN | MACAEDWRRLVLVPSHRSHGIKMPGRSPGSPSSW | LVLVPSHRSHGIK | No | Alternative | Alternative | 13 | 1 | ATG | TGA | NA | No |
chr8|55950458|55953984|+|4|circRNA|LYN|ENST00000519728.5|5,6,7,8 | circLYN(5,6,7,8) | LYN | LCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGMENGGKQSPF | LGAGQFGEVWMGMENGGK | No | Junction | Junction | 18 | 3 | TTG | TAA | TransCirc | No |
chr8|55950458|55953984|+|4|circRNA|LYN|ENST00000519728.5|5,6,7,8 | circLYN(5,6,7,8) | LYN | LCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGMENGGKQSPF | RLGAGQFGEVWMGMENGGK | No | Junction | Junction | 19 | 3 | TTG | TAA | TransCirc | No |
chr8|55953831|55966897|+|2|circRNA|LYN|ENST00000519728.5|8,9 | circLYN(8,9) | LYN | LWSPGRSPFTSSPSTWPRSRQMACAEDWRRLVLVPSHRSHGIKMPGRSPGSPSSW | LWSPGRSPFTSSPSTWPR | No | Alternative | Junction | 18 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page