top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|22781420|22785076|+|2|circRNA|EPHB2|NM_001309192|2,3 | circEPHB2(2,3) | EPHB2 | LDGESMGEGGYHCSRRELLPGGPGWPRHENQHRGAELRTCVPQRLLPGLPGLWRLHVPHRRACLLPQVPPHHPEWRHLPGNPVGG | ELLPGGPGWPR | No | Alternative | Alternative | 11 | 3 | CTG | TGA | TransCirc | No |
chr1|228213440|228215098|+|3|circRNA|OBSCN|ENST00000284548.15|3,4,5 | circOBSCN(3,4,5) | OBSCN | LMWRRRGTSSSECPLSTALVRVPTSSSRGLSTWSPRFPSKSGCKIWRCGRRSRPRSYVRCPSRPLRPRGSRRRRGCGRAPSTASRRRAPSAA | VPTSSSR | No | Alternative | Junction | 7 | 1 | CTG | TGA | TransCirc | No |
chr1|228213440|228245688|+|10|circRNA|OBSCN|ENST00000284548.15|3,4,5,6,7,8,9,10,11,12 | circOBSCN(3,4,5,6,7,8,9,10,11,12) | OBSCN | LHTKAGSAAGGQSRCWGVQLRGWGPESLLSTAHHRARGSLQKAAARSGGAGEGVGHVPM | AAARSGGAGEGVGHVPM | No | Alternative | Junction | 17 | 2 | CTG | TGA | NA | No |
chr1|228213440|228245688|+|10|circRNA|OBSCN|ENST00000284548.15|3,4,5,6,7,8,9,10,11,12 | circOBSCN(3,4,5,6,7,8,9,10,11,12) | OBSCN | LHTKAGSAAGGQSRCWGVQLRGWGPESLLSTAHHRARGSLQKAAARSGGAGEGVGHVPM | AGSAAGGQSR | No | Alternative | Junction | 10 | 2 | CTG | TGA | TransCirc | No |
chr1|228213440|228245688|+|10|circRNA|OBSCN|ENST00000284548.15|3,4,5,6,7,8,9,10,11,12 | circOBSCN(3,4,5,6,7,8,9,10,11,12) | OBSCN | MLGSTAARLGARESPFNCTSQSPRFPSKSGCKIWRCGRRSRPRSYVRCPSRPLRPRGSRRRRGCGRAPSTASRRRAPSAA | MLGSTAAR | No | Alternative | Junction | 8 | 1 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page