top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|198232552|198293039|+|7|circRNA|NEK7|ENST00000367385.8|2,3,4,5,6,7,8 | circNEK7(2,3,4,5,6,7,8) | NEK7 | MSPERIHENGYNFKSDIWSLGCLLYESSKVPVASDNG | SDIWSLGCLLYESSKVPVASDNG | No | Junction | Junction | 23 | 3 | ATG | TGA | TransCirc | No |
chr1|200581200|200603955|-|12|circRNA|KIF14|ENST00000614960.4|19,18,17,16,15,14,13,12,11,10,9,8 | circKIF14(19,18,17,16,15,14,13,12,11,10,9,8) | KIF14 | MKLSMMIQEANAISSKLKTYYVFGRQNLWKGKNTITE | TYYVFGRQNLWK | No | Junction | Junction | 12 | 3 | ATG | TAA | TransCirc | No |
chr1|201996146|201997554|+|2|circRNA|RNPEP|ENST00000481780.5|4,5 | circRNPEP(4,5) | RNPEP | LGTAPWQMSSSMRSPTVGLGTWSPTPTGVNSGSMKVSPCTPRGGSPPSSLEPGVG | GGSPPSSLEPGVG | No | Junction | Junction | 13 | 3 | CTG | TGA | TransCirc | No |
chr1|202422619|202431619|+|6|circRNA|PPP1R12B|ENST00000608999.5|3,4,5,6,7,8 | circPPP1R12B(3,4,5,6,7,8) | PPP1R12B | MLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAGISLITEPV | EAGISLITEPV | No | Junction | Junction | 11 | 2 | ATG | TAG | TransCirc | No |
chr1|202422619|202431619|+|6|circRNA|PPP1R12B|ENST00000608999.5|3,4,5,6,7,8 | circPPP1R12B(3,4,5,6,7,8) | PPP1R12B | MRRRHLSPKKWRKKIKNLVAPAQRRRKVKMKLLSQKLRRRQVFH | MKLLSQK | No | Alternative | Junction | 7 | 3 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page