top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|17412121|17413717|-|3|circRNA|RCC2|NM_001136204|10,9,8 | circRCC2(10,9,8) | RCC2 | LWPPMRAPSAGVRHRPLGNCWSWTPRSESSPGALVAMAGWATQSRRMRWSPAW | APSAGVR | No | Alternative | Junction | 7 | 3 | TTG | TGA | TransCirc | No |
chr1|17412121|17416646|-|4|circRNA|RCC2|NM_001136204|10,9,8,7 | circRCC2(10,9,8,7) | RCC2 | LWPPMRAPSAGVRHRPLGNWTQLRWEVHRPGTADRVRL | APSAGVRHRPLGNWTQLR | No | Junction | Junction | 18 | 3 | TTG | TGA | TransCirc | No |
chr1|17412121|17416646|-|4|circRNA|RCC2|NM_001136204|10,9,8,7 | circRCC2(10,9,8,7) | RCC2 | LWPPMRAPSAGVRHRPLGNWTQLRWEVHRPGTADRVRL | HRPLGNWTQLR | No | Junction | Junction | 11 | 3 | TTG | TGA | TransCirc | No |
chr1|175986942|176027688|-|4|circRNA|RFWD2|NM_001001740|17,16,15,14 | circRFWD2(17,16,15,14) | RFWD2 | LIQSKVFSTKTEKKMIQMNLLVLCAGGHYQMGEAVVYQSRQLSGKH | KMIQMNLLVLCAGGHYQMGEAVVYQSR | No | Junction | Junction | 27 | 1 | TTG | TGA | TransCirc | No |
chr1|175986942|176046324|-|7|circRNA|RFWD2|NM_001001740|17,16,15,14,13,12,11 | circRFWD2(17,16,15,14,13,12,11) | RFWD2 | LEGTTRWVLNLTGIVTILRLLELQRRLKSMNMTLSSRMQWIFITLRMK | LLELQRR | No | Alternative | Junction | 7 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page