top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|151303540|151316509|-|4|circRNA|PI4KB|NM_001198773|7,6,5,4 | circPI4KB(7,6,5,4) | PI4KB | LWTASPARRARSLCSLQQGTSAWKLEVWLWPWEIQ | LWTASPAR | No | Alternative | Junction | 8 | 2 | CTG | TAG | TransCirc | No |
chr1|151423396|151442205|-|8|circRNA|POGZ|ENST00000358476.7|9,8,7,6,5,4,3,2 | circPOGZ(9,8,7,6,5,4,3,2) | POGZ | MNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYESTTWRTPTCSWNVRRRSWSHGRKSVMSLRTL | KSVMSLR | No | Alternative | Junction | 7 | 2 | ATG | TAG | TransCirc | No |
chr1|151423396|151442205|-|8|circRNA|POGZ|ENST00000358476.7|9,8,7,6,5,4,3,2 | circPOGZ(9,8,7,6,5,4,3,2) | POGZ | MNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYESTTWRTPTCSWNVRRRSWSHGRKSVMSLRTL | QFSTPFQLQCHLENVHSPYESTTWRTPTCSWNVR | No | Junction | Junction | 34 | 2 | ATG | TAG | TransCirc | No |
chr1|151518505|151520691|+|4|circRNA|CGN|NM_020770|2,3,4,5 | circCGN(2,3,4,5) | CGN | MQEPVPTGLLCVCRESLGSPLWCSTVGRKAVTPLGSKSRGPMTKGPQEL | ESLGSPLWCSTVGRK | No | Alternative | Alternative | 15 | 1 | ATG | TGA | NA | No |
chr1|151518505|151520691|+|4|circRNA|CGN|NM_020770|2,3,4,5 | circCGN(2,3,4,5) | CGN | MQEPVPTGLLCVCRESLGSPLWCSTVGRKAVTPLGSKSRGPMTKGPQEL | MQEPVPTGLLCVCR | No | Alternative | Alternative | 14 | 1 | ATG | TGA | NA | No |
Page 1 of 1
bottom of page