top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|1256991|1267992|-|5|circRNA|UBE2J2|ENST00000450390.6|6,5,4,3,2 | circUBE2J2(6,5,4,3,2) | UBE2J2 | LVCLHHPDWAPELHGGEGPHPGQYRDVGLHDEQHQQ | DVGLHDEQHQQ | Yes | Junction | Junction | 11 | 1 | CTG | TAA | riboCIRC,TransCirc | No |
chr1|12578717|12580666|-|3|circRNA|DHRS3|ENST00000616661.4|4,3,2 | circDHRS3(4,3,2) | DHRS3 | LPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRLFSGAGLRNA | LFSGAGLR | No | Alternative | Junction | 8 | 1 | CTG | TGA | riboCIRC,TransCirc | No |
chr1|1337976|1338653|-|3|circRNA|DVL1|ENST00000378891.9|14,13,12 | circDVL1(14,13,12) | DVL1 | LPPGLWVRATPTSTRDPHPASRLPTRTRALAMAAAAPGVSRVKSWKRRR | ALAMAAAAPGVSR | No | Alternative | Junction | 13 | 1 | CTG | TGA | TransCirc | No |
chr1|13769117|13782831|+|3|circRNA|PRDM2|ENST00000343137.8|2,3,4 | circPRDM2(2,3,4) | PRDM2 | LPCKSPELKKRPMVMYLKRLCFRVNIVKGSLQPNRGLSVTCISIYPPSIMLSNASTVGKPLAHRLTGGDMSGAMKQG | RPMVMYLKR | No | Alternative | Alternative | 9 | 1 | CTG | TAA | riboCIRC | No |
chr1|13769117|13782831|+|3|circRNA|PRDM2|ENST00000343137.8|2,3,4 | circPRDM2(2,3,4) | PRDM2 | LQVVTKTVTATTADGQRMRRLKCKACRLRWARPEPAAQAPPKSHFPPHPSGPSRTSSLQLR | TVTATTADGQR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | riboCIRC | No |
Page 1 of 1
bottom of page