top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|109336239|109342158|-|3|circRNA|SORT1|NM_001205228|11,10,9 | circSORT1(11,10,9) | SORT1 | LKTVNVMLQQKTRMRIQQEGSTFQQIKGTHGAWPSSPPWDRNSSILFWQQMMTWYSCM | MRIQQEGSTFQQIK | No | Junction | Junction | 14 | 1 | CTG | TAG | riboCIRC,TransCirc | No |
chr1|109336239|109342158|-|3|circRNA|SORT1|NM_001205228|11,10,9 | circSORT1(11,10,9) | SORT1 | LKTVNVMLQQKTRMRIQQEGSTFQQIKGTHGAWPSSPPWDRNSSILFWQQMMTWYSCM | TVNVMLQQK | No | Alternative | Junction | 9 | 1 | CTG | TAG | riboCIRC,TransCirc | No |
chr1|110038682|110043856|+|8|circRNA|STRIP1|ENST00000369796.5|3,4,5,6,7,8,9,10 | circSTRIP1(3,4,5,6,7,8,9,10) | STRIP1 | LIKQDNLDAFNERDPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVRALQLHGRARIPDESKML | ALQLHGRAR | No | Alternative | Junction | 9 | 1 | CTG | TGA | TransCirc | No |
chr1|11018732|11020599|+|2|circRNA|TARDBP|ENST00000240185.7|4,5 | circTARDBP(4,5) | TARDBP | MSSSPSHSGPLPLLHLQMIRSRKILRLVIQRGLALFVLRNMKHK | GLALFVLRNMK | No | Alternative | Junction | 11 | 2 | ATG | TGA | TransCirc | No |
chr1|110222963|110223900|+|1|circRNA|KCNC4|NM_001039574|2 | circKCNC4(2) | KCNC4 | LVGCGHHDDTGLRRHVPQDVVRHAGRGTVCTGWRAHHRHAGACHRQQLRHVLLPGHGQAEAAQETEEARATAGAAGVTHVLQV | HVPQDVVR | No | Alternative | Alternative | 8 | 1 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page