top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|10363282|10365648|+|3|circRNA|KIF1B|NM_015074|39,40,41 | circKIF1B(39,40,41) | KIF1B | LLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATKESSHWHLRTQLMQNVRHR | TQLMQNVR | No | Alternative | Junction | 8 | 1 | TTG | TAG | TransCirc | No |
chr1|10363282|10365648|+|3|circRNA|KIF1B|NM_015074|39,40,41 | circKIF1B(39,40,41) | KIF1B | LLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATKESSHWHLRTQLMQNVRHR | TQLMQNVRHR | No | Alternative | Junction | 10 | 1 | TTG | TAG | TransCirc | No |
chr1|10365099|10365648|+|2|circRNA|KIF1B|NM_015074|40,41 | circKIF1B(40,41) | KIF1B | LKAPSHLARAVAMIQETSKAWWTERKSWLPRYAEKEKKNLRYVSGICAGRRELSRLAAPWRQPHP | AVAMIQETSKAWWTER | No | Alternative | Junction | 16 | 2 | TTG | TGA | TransCirc | No |
chr1|108730673|108733532|+|2|circRNA|FNDC7|ENST00000370017.7|9,10 | circFNDC7(9,10) | FNDC7 | MASGSTGKPPGALPITALTSMAPKAFSRAPRVLASVSVMSLRYPVGMYTL | APRVLASVSVMSLR | No | Alternative | Alternative | 14 | 1 | ATG | TGA | TransCirc | No |
chr1|108982608|109011718|-|8|circRNA|WDR47|ENST00000400794.7|12,11,10,9,8,7,6,5 | circWDR47(12,11,10,9,8,7,6,5) | WDR47 | LEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRGQGLHALSGHTAGIYHARSCAMFTCSRRILSF | SCAMFTCSRR | No | Alternative | Junction | 10 | 3 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page