top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|16106737|16115076|+|3|circRNA|ABCC1|ENST00000399410.7|21,22,23 | circABCC1(21,22,23) | ABCC1 | LHRYPAGHAHRRHHHPAPWPHLLLRPDSSAAPPPIVGTSAGTTTAPQNCRKLRPRRRRPGS | YPAGHAHR | No | Alternative | Junction | 8 | 2 | CTG | TGA | TransCirc | No |
chr16|16121974|16124915|+|2|circRNA|ABCC1|ENST00000399410.7|24,25 | circABCC1(24,25) | ABCC1 | LHRSVCCPVCGDLQAQPQCWLGGPLSVLLIAEVLRGFLPAAEAPRVGQPLPGLFPFQRDLAGGQRHSSLRGAGALHPPE | GFLPAAEAPR | No | Alternative | Junction | 10 | 1 | CTG | TGA | TransCirc | No |
chr16|18549520|18557791|-|4|circRNA|NOMO2|ENST00000330537.10|5,4,3,2 | circNOMO2(5,4,3,2) | NOMO2 | LGPKQRSSPQLHSLAENKAVHQAWDFEIPDRLCP | AVHQAWDFEIPDR | No | Alternative | Junction | 13 | 2 | CTG | TAA | TransCirc | No |
chr16|18838550|18870711|-|26|circRNA|SMG1|NM_015092|43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18 | circSMG1(43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18) | SMG1 | MSMVGYIIGLGDRHLDNVLIDMTTGEVVHIDYNVCFEKDVSMFAVFN | HLDNVLIDMTTGEVVHIDYNVCFEKDVSMFAVFN | No | Junction | Junction | 34 | 1 | ATG | TAG | TransCirc | No |
chr16|19180390|19184147|+|2|circRNA|SYT17|NM_016524|4,5 | circSYT17(4,5) | SYT17 | MARARTWRTPTPTSRSVSCQTRRTQSRPGSNARPRSPCLRSATPSRSPSWRPRGGPCS | TQSRPGSNARPR | No | Alternative | Alternative | 12 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page