top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|85734991|85736134|+|3|circRNA|AKAP13|NM_006738|31,32,33 | circAKAP13(31,32,33) | AKAP13 | MLTWYLCLKETVSGDPSGFGEWKSGRHTWADCQQPH | ETVSGDPSGFGEWKSGR | No | Junction | Junction | 17 | 2 | ATG | TGA | TransCirc | No |
chr15|89102499|89155534|+|7|circRNA|ABHD2|NM_007011|3,4,5,6,7,8,9 | circABHD2(3,4,5,6,7,8,9) | ABHD2 | MISPWSSALELPITARSNTSALSLTTPRKMAIGAPC | SNTSALSLTTPR | No | Alternative | Alternative | 12 | 1 | ATG | TGA | TransCirc | No |
chr15|89261584|89305698|+|26|circRNA|FANCI|ENST00000300027.12|5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30 | circFANCI(5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30) | FANCI | LSQAEKVLEEVDWLITKLKGQVSQETLSGSPFSRTIIG | LKGQVSQETLSGSPFSR | No | Junction | Junction | 17 | 1 | CTG | TGA | TransCirc | No |
chr15|89281169|89293997|+|9|circRNA|FANCI|ENST00000300027.12|15,16,17,18,19,20,21,22,23 | circFANCI(15,16,17,18,19,20,21,22,23) | FANCI | LSLFMCYKKLSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRPAFKYRHVCTLSSSKLFF | HVCTLSSSKLFF | No | Alternative | Junction | 12 | 2 | CTG | TAA | TransCirc | No |
chr15|89329146|89330080|-|1|ciRNA|POLG|NM_001126131|3 | ciPOLG(3) | POLG | LQVLAWDGPGALISVVRGGTPFLARVSVAFAEAARRIC | GGTPFLAR | No | Alternative | Alternative | 8 | 2 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page