top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|59671182|59680308|-|5|circRNA|BNIP2|ENST00000267859.7|7,6,5,4,3 | circBNIP2(7,6,5,4,3) | BNIP2 | MVQQLEEKCPVWDGSGNVISKLIEDLYQKMIVLKQIY | LIEDLYQKMIVLK | No | Junction | Junction | 13 | 3 | ATG | TAG | TransCirc | No |
chr15|60442415|60468322|-|9|circRNA|ICE2|ENST00000261520.8|12,11,10,9,8,7,6,5,4 | circICE2(12,11,10,9,8,7,6,5,4).A | ICE2 | MSRQLVQQLKQRKKLKPQLEWFFFQNQEFLILVSLVSHRESRGVMWTCWLNTQRFLQIPKLLE | MSRQLVQQLK | No | Alternative | Alternative | 10 | 1 | ATG | TAA | NA | No |
chr15|61949442|61977199|-|19|circRNA|VPS13C|ENST00000249837.7|40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22 | circVPS13C(40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22) | VPS13C | LWGSPEVSLSKLRKPGKSVDFSIHQLCIYCNPWIFMLSWLRPW | LWGSPEVSLSK | No | Alternative | Junction | 11 | 2 | TTG | TAG | NA | No |
chr15|61949442|61977199|-|19|circRNA|VPS13C|ENST00000249837.7|40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22 | circVPS13C(40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22) | VPS13C | LWGSPEVSLSKLRKPGKSVDFSIHQLCIYCNPWIFMLSWLRPW | SVDFSIHQLCIYCNPWIFMLSWLRPW | No | Alternative | Junction | 26 | 2 | TTG | TAG | NA | No |
chr15|63071275|63071657|-|1|ciRNA|RP11-244F12.2|ENST00000558905.1|1 | ciRP11-244F12.2(1) | RP11-244F12.2 | LNGTSSALVRIPTLTKHTVLLNSLQSVAASTREMAHLNQDRPDMGLPFCMCFPHPLT | LNGTSSALVR | No | Alternative | Alternative | 10 | 2 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page