top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|45658906|45676310|+|5|circRNA|SQRDL|ENST00000568606.5|3,4,5,6,7 | circSQRDL(3,4,5,6,7) | SQRDL | LILPEDGATGGCGIRAPCPALCLPAQAGHSAGRPPSAAHRGQPCGQEPL | LILPEDGATGGCGIR | No | Alternative | Alternative | 15 | 2 | CTG | TGA | TransCirc | No |
chr15|48752348|48805656|-|20|circRNA|CEP152|ENST00000380950.6|21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2 | circCEP152(21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2) | CEP152 | MAELSKDSASQGTGQGDPGPAAGHHAQPLALQATEAEAGGPCH | MAELSKDSASQGTGQGDPGPAAGHHAQPLALQATEAEAGGPCH | No | Junction | Junction | 43 | 1 | ATG | TAG | TransCirc | No |
chr15|49011730|49028682|-|9|circRNA|SECISBP2L|ENST00000559471.5|13,12,11,10,9,8,7,6,5 | circSECISBP2L(13,12,11,10,9,8,7,6,5) | SECISBP2L | LMTCHRRLFPRKISHQISLTSLSQRPLQQCSGSPRAGEEEHPTLLLNLLVSRGLVKPTLTVIVVTAVPNTATTSLQQGL | AGEEEHPTLLLNLLVSR | No | Alternative | Junction | 17 | 2 | TTG | TGA | TransCirc | No |
chr15|49011730|49028682|-|9|circRNA|SECISBP2L|ENST00000559471.5|13,12,11,10,9,8,7,6,5 | circSECISBP2L(13,12,11,10,9,8,7,6,5) | SECISBP2L | LMTCHRRLFPRKISHQISLTSLSQRPLQQCSGSPRAGEEEHPTLLLNLLVSRGLVKPTLTVIVVTAVPNTATTSLQQGL | ISHQISLTSLSQRPLQQCSGSPR | No | Alternative | Junction | 23 | 2 | TTG | TGA | TransCirc | No |
chr15|49011730|49028682|-|9|circRNA|SECISBP2L|ENST00000559471.5|13,12,11,10,9,8,7,6,5 | circSECISBP2L(13,12,11,10,9,8,7,6,5) | SECISBP2L | LMTCHRRLFPRKISHQISLTSLSQRPLQQCSGSPRAGEEEHPTLLLNLLVSRGLVKPTLTVIVVTAVPNTATTSLQQGL | LMTCHRR | No | Alternative | Junction | 7 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page