top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|43401850|43403681|+|1|ciRNA|TUBGCP4|NM_001286414|15 | ciTUBGCP4(15) | TUBGCP4 | MSWLLFLSVLQHSCYRLFKNVLVFRAISAVPGRVRYILIDATPEGWLKTTKNYCDG | AISAVPGR | No | Alternative | Alternative | 8 | 1 | ATG | TAG | NA | No |
chr15|43415593|43480017|-|18|circRNA|TP53BP1|ENST00000382044.8|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6 | circTP53BP1(23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6) | TP53BP1 | LILPHHSWVLGFWNSPRARMLRKILCHMKWTKSSYNQ | LILPHHSWVLGFWNSPR | No | Junction | Junction | 17 | 1 | CTG | TAA | NA | No |
chr15|43415593|43480017|-|18|circRNA|TP53BP1|ENST00000382044.8|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6 | circTP53BP1(23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6) | TP53BP1 | LILPHHSWVLGFWNSPRARMLRKILCHMKWTKSSYNQ | LILPHHSWVLGFWNSPRAR | No | Junction | Junction | 19 | 1 | CTG | TAA | NA | No |
chr15|43756648|43769646|+|8|circRNA|PDIA3|NM_005313|3,4,5,6,7,8,9,10 | circPDIA3(3,4,5,6,7,8,9,10) | PDIA3 | LNFMPLGVVTVRTWSPSIKNLARRLIALPTLTPVINMESVDIQP | LNFMPLGVVTVR | No | Alternative | Junction | 12 | 2 | TTG | TGA | TransCirc | No |
chr15|44554552|44557650|+|2|circRNA|EIF3J|ENST00000261868.9|5,6 | circEIF3J(5,6) | EIF3J | MNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISFRRTRRT | DVCISFR | No | Alternative | Junction | 7 | 3 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page