top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22 | circCASC5(13,14,15,16,17,18,19,20,21,22) | CASC5 | LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA | LSGMSLSGVMIK | No | Alternative | Junction | 12 | 3 | CTG | TGA | TransCirc | No |
chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22 | circCASC5(13,14,15,16,17,18,19,20,21,22) | CASC5 | LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA | LSGMSLSGVMIKLYSPLFMTR | No | Alternative | Junction | 21 | 3 | CTG | TGA | TransCirc | No |
chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22 | circCASC5(13,14,15,16,17,18,19,20,21,22) | CASC5 | LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA | LYSPLFMTR | No | Alternative | Junction | 9 | 3 | CTG | TGA | TransCirc | No |
chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22 | circCASC5(13,14,15,16,17,18,19,20,21,22) | CASC5 | LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA | SQLLTAVVKWNHSFSEILFVK | No | Junction | Junction | 21 | 3 | CTG | TGA | TransCirc | No |
chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22 | circCASC5(13,14,15,16,17,18,19,20,21,22) | CASC5 | LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA | YNSPSPLK | No | Alternative | Junction | 8 | 3 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page